-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRF9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IRF9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14623A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRF9 |
| Target Synonyms | p48; IRF-9; ISGF3; ISGF3G; F9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSME | Uniprot ID | Q00978 |
Uniprot Id
Q00978
Target Species
Human
Target Name
IRF9
Target Full Name
Interferon regulatory factor 9
Target Function
Transcription factor that plays an essential role in anti-viral immunity. It mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Translocated into the nucleus upon activation by IFN-alpha/beta.
Target Protein Families
IRF family
Target Synonyms
p48; IRF-9; ISGF3; ISGF3G; F9
Target Background
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65.
Notification