Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1043-1242 of human IRS1 (NP_005535.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IRS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1043-1242 of human IRS1 (NP_005535.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12273A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRS1 |
| Target Synonyms | HIRS-1; IRS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1043-1242 of human IRS1 (NP_005535.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ | Uniprot ID | P35568 |
Uniprot Id
P35568
Target Species
Human
Target Name
IRS1
Target Full Name
Insulin receptor substrate 1
Target Function
May mediate the control of various cellular processes by insulin. When phosphorylated by the insulin receptor binds specifically to various cellular proteins containing SH2 domains such as phosphatidylinositol 3-kinase p85 subunit or GRB2. Activates phosphatidylinositol 3-kinase when bound to the regulatory p85 subunit.
Target Involvement
Diabetes mellitus, non-insulin-dependent (NIDDM)
Target Synonyms
HIRS 1; HIRS1; Insulin receptor substrate 1; IRS 1; IRS-1; IRS1; IRS1_HUMAN; OTTHUMP00000164234
Target Background
This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
