Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ISG20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ISG20 (NP_002192.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ISG20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ISG20 (NP_002192.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10824A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ISG20 |
| Target Synonyms | CD25; HEM45; ISG20 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF7, Mouse spleen, Raji, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ISG20 (NP_002192.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF | Uniprot ID | Q96AZ6 |
Uniprot Id
Q96AZ6
Target Species
Human
Target Name
ISG20
Target Full Name
Interferon-stimulated gene 20 kDa protein
Target Function
Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV) in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Cytoplasm. Nucleus, Cajal body.
Target Protein Families
Exonuclease superfamily
Target Tissue Specificity
Highly expressed in peripheral blood leukocytes, spleen, thymus, colon and lung. Up regulated by E2 in estrogen receptor-positive breast cancer lines.
Target Synonyms
CD25; Estrogen regulated transcript 45 protein; Estrogen-regulated transcript 45 protein; HEM45; Interferon stimulated exonuclease gene 20kDa; Interferon stimulated gene 20 kDa protein; Interferon-stimulated gene 20 kDa protein; Isg20; ISG20_HUMAN; Promyelocytic leukemia nuclear body associated protein; Promyelocytic leukemia nuclear body-associated protein ISG20
Target Background
Enables 3'-5' exonuclease activity and RNA binding activity. Involved in defense response to virus; negative regulation of viral genome replication; and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
