-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITGB6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 732-788 of human ITGB6 (NP_000879.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITGB6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 732-788 of human ITGB6 (NP_000879.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10807A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITGB6 |
| Target Synonyms | AI1H; ITGB6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 732-788 of human ITGB6 (NP_000879.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC | Uniprot ID | P18564 |
Uniprot Id
P18564
Target Species
Human
Target Name
ITGB6
Target Full Name
Integrin beta-6
Target Function
Integrin alpha-V:beta-6 (ITGAV:ITGB6) is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalization of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion. ITGAV:ITGB6 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1. Integrin alpha-V:beta-6 (ITGAV:ITGB6) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation.; (Microbial infection) Integrin ITGAV:ITGB6 acts as a receptor for Coxsackievirus A9 and Coxsackievirus B1.; (Microbial infection) Integrin ITGAV:ITGB6 acts as a receptor for Herpes simplex virus-1/HHV-1.
Target Involvement
Amelogenesis imperfecta 1H (AI1H)
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell junction, focal adhesion.
Target Protein Families
Integrin beta chain family
Target Synonyms
ITGB6; Integrin beta-6
Target Background
This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms a dimer with an alpha v chain and this heterodimer can bind to ligands like fibronectin and transforming growth factor beta 1. Alternate splicing results in multiple transcript variants.
Notification