-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITM2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 81-266 of human ITM2B (NP_068839.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITM2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 81-266 of human ITM2B (NP_068839.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05433A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITM2B |
| Target Synonyms | BRI; FBD; ABRI; BRI2; E25B; E3-16; RDGCA; imBRI2; BRICD2B; ITM2B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 81-266 of human ITM2B (NP_068839.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS | Uniprot ID | Q9Y287 |
Uniprot Id
Q9Y287
Target Species
Human
Target Name
ITM2B
Target Full Name
Integral membrane protein 2B
Target Function
Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a protease inhibitor by blocking access of secretases to APP cleavage sites.; Mature BRI2 (mBRI2) functions as a modulator of the amyloid-beta A4 precursor protein (APP) processing leading to a strong reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42.; Bri23 peptide prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers.
Target Involvement
Cerebral amyloid angiopathy, ITM2B-related 1 (CAA-ITM2B1); Cerebral amyloid angiopathy, ITM2B-related 2 (CAA-ITM2B2); Retinal dystrophy with inner retinal dysfunction and ganglion cell abnormalities (RDGCA)
Target Subcellular Location
[Integral membrane protein 2B]: Golgi apparatus membrane; Single-pass type II membrane protein.; [Bri23 peptide]: Secreted.; [BRI2C, soluble form]: Secreted.
Target Protein Families
ITM2 family
Target Tissue Specificity
Ubiquitous. Expressed in brain.
Target Synonyms
ABRI; ABri/ADan amyloid peptide; BRI 2; BRI; BRI2; BRICD 2B; BRICD2B; BRICHOS domain containing 2B; E25B; E3 16; E3-16; FBD; imBRI2; Immature BRI2; Integral membrane protein 2B; ITM 2B; ITM2B; ITM2B_HUMAN; Protein E25B; RDGCA; Transmembrane protein BRI
Target Background
Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia.
Notification