Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITPR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2415-2480 of human ITPR2 (NP_002214.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against ITPR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2415-2480 of human ITPR2 (NP_002214.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of ITPR2 in paraffin-embedded rat lung using ITPR2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-10606A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITPR2 |
| Target Synonyms | ANHD; IP3R2; CFAP48; INSP3R2; ITPR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2415-2480 of human ITPR2 (NP_002214.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTCD | Uniprot ID | Q14571 |
Uniprot Id
Q14571
Target Species
Human
Target Name
ITPR2
Target Full Name
Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2
Target Function
Receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. This release is regulated by cAMP both dependently and independently of PKA.
Target Involvement
Anhidrosis, isolated, with normal sweat glands (ANHD)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
InsP3 receptor family
Target Tissue Specificity
Isoform Short is found in skeletal muscle and heart.
Target Synonyms
4; 5-trisphosphate receptor; Inositol 1 4 5 trisphosphate receptor type 2; Inositol 1,4,5-trisphosphate receptor type 2; Inositol 145 trisphosphate receptor type 2; InsP3 R2; InsP3R2; IP3 R2; IP3 receptor; IP3 receptor isoform 2; IP3R 2; IP3R2; ITPR 2; Itpr2; ITPR2_HUMAN; Type 2 inositol 1 4 5 trisphosphate receptor; Type 2 inositol 1; Type 2 inositol 145 trisphosphate receptor; Type 2 InsP3 receptor
Target Background
The protein encoded by this gene belongs to the inositol 1, 4, 5-triphosphate receptor family, whose members are second messenger intracellular calcium release channels. These proteins mediate a rise in cytoplasmic calcium in response to receptor activated production of inositol triphosphate. Inositol triphosphate receptor-mediated signaling is involved in many processes including cell migration, cell division, smooth muscle contraction, and neuronal signaling. This protein is a type 2 receptor that consists of a cytoplasmic amino-terminus that binds inositol triphosphate, six membrane-spanning helices that contribute to the ion pore, and a short cytoplasmic carboxy-terminus. A mutation in this gene has been associated with anhidrosis, suggesting that intracellular calcium release mediated by this protein is required for eccrine sweat production.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
