-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JAG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 34-180 of human JAG1 (NP_000205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against JAG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 34-180 of human JAG1 (NP_000205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03220A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JAG1 |
| Target Synonyms | AGS; AHD; AWS; HJ1; AGS1; DCHE; CD339; JAGL1; CMT2HH; JAG1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 34-180 of human JAG1 (NP_000205.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE | Uniprot ID | P78504 |
Uniprot Id
P78504
Target Species
Human
Target Name
JAG1
Target Full Name
Protein jagged-1
Target Function
Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. Enhances fibroblast growth factor-induced angiogenesis (in vitro).
Target Involvement
Alagille syndrome 1 (ALGS1); Tetralogy of Fallot (TOF)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Widely expressed in adult and fetal tissues. In cervix epithelium expressed in undifferentiated subcolumnar reserve cells and squamous metaplasia. Expression is up-regulated in cervical squamous cell carcinoma. Expressed in bone marrow cell line HS-27a wh
Target Synonyms
AGS; AHD; AWS; CD 339; CD339; CD339 antigen; Headturner ; hJ1; Htu; Jag 1; Jag1; JAG1_HUMAN; Jagged 1; Jagged1 (Alagille syndrome) ; Jagged1; JAGL1; MGC104644; OTTHUMP00000030278; Protein jagged-1; Ser 1; Ser1; Serrate 1; Slalom
Target Background
The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter is involved in signaling processes. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.
Notification