Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JAG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-180 of human JAG1 (NP_000205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against JAG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-180 of human JAG1 (NP_000205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12448A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JAG1 |
| Target Synonyms | AGS; AHD; AWS; HJ1; AGS1; DCHE; CD339; JAGL1; CMT2HH; JAG1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HT-29 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 34-180 of human JAG1 (NP_000205.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE | Uniprot ID | P78504 |
Uniprot Id
P78504
Target Species
Human
Target Name
JAG1
Target Full Name
Protein jagged-1
Target Function
Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. Enhances fibroblast growth factor-induced angiogenesis (in vitro).
Target Involvement
Alagille syndrome 1 (ALGS1); Tetralogy of Fallot (TOF)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Widely expressed in adult and fetal tissues. In cervix epithelium expressed in undifferentiated subcolumnar reserve cells and squamous metaplasia. Expression is up-regulated in cervical squamous cell carcinoma. Expressed in bone marrow cell line HS-27a wh
Target Synonyms
AGS; AHD; AWS; CD 339; CD339; CD339 antigen; Headturner ; hJ1; Htu; Jag 1; Jag1; JAG1_HUMAN; Jagged 1; Jagged1 (Alagille syndrome) ; Jagged1; JAGL1; MGC104644; OTTHUMP00000030278; Protein jagged-1; Ser 1; Ser1; Serrate 1; Slalom
Target Background
The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter is involved in signaling processes. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
