Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human JDP2 (NP_001128521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against JDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human JDP2 (NP_001128521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10125A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JDP2 |
| Target Synonyms | JUNDM2; JDP2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Jurkat, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human JDP2 (NP_001128521.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVAGWPATPPAMMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK | Uniprot ID | Q8WYK2 |
Uniprot Id
Q8WYK2
Target Species
Human
Target Name
JDP2
Target Full Name
Jun dimerization protein 2
Target Function
Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, ATF subfamily
Target Synonyms
Jdp2; JDP2_HUMAN; Jun dimerization protein 2; JUNDM2; Progesterone receptor co-activator
Target Background
Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in negative regulation of transcription by RNA polymerase II. Predicted to be part of chromatin. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
