-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Kaiso/ZBTB33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.
The antibody against Kaiso/ZBTB33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.
| Cat.No | ADA-03322A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Kaiso/ZBTB33 |
| Target Synonyms | ZNF348; ZNF-kaiso; Kaiso/ZBTB33 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse skeletal muscle, U-87MG | Application | ELISA, WB, ChIP, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human Kaiso/Kaiso/ZBTB33 (NP_006768.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY | Uniprot ID | Q86T24 |
Uniprot Id
Q86T24
Target Species
Human
Target Name
ZBTB33
Target Full Name
Transcriptional regulator Kaiso
Target Function
Transcriptional regulator with bimodal DNA-binding specificity. Binds to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3' and also binds to the non-methylated consensus sequence 5'-CTGCNA-3' also known as the consensus kaiso binding site (KBS). Recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. May contribute to the repression of target genes of the Wnt signaling pathway. May also activate transcription of a subset of target genes by the recruitment of CTNND2. Represses expression of MMP7 in conjunction with transcriptional corepressors CBFA2T3, CBFA2T2 and RUNX1T1.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Also cytoplasmic in cells grown at high densities.
Target Tissue Specificity
Expressed in vascular endothelium.
Target Synonyms
Kaiso; Kaiso protein; Kaiso transcription factor; KAISO_HUMAN; Transcriptional regulator Kaiso; ZBTB 33; Zbtb33; Zinc finger and BTB domain containing 33; Zinc finger and BTB domain-containing protein 33; Zinc finger transcription factor Kaiso; ZNF 348; ZNF Kaiso; ZNF348
Target Background
This gene encodes a transcriptional regulator with bimodal DNA-binding specificity, which binds to methylated CGCG and also to the non-methylated consensus KAISO-binding site TCCTGCNA. The protein contains an N-terminal POZ/BTB domain and 3 C-terminal zinc finger motifs. It recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway, and may also activate transcription of a subset of target genes by the recruitment of catenin delta-2 (CTNND2). Its interaction with catenin delta-1 (CTNND1) inhibits binding to both methylated and non-methylated DNA. It also interacts directly with the nuclear import receptor Importin-α2 (also known as karyopherin alpha2 or RAG cohort 1), which may mediate nuclear import of this protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Notification