-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KATNB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human KATNB1 (NP_005877.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KATNB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human KATNB1 (NP_005877.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07630A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KATNB1 |
| Target Synonyms | KAT; LIS6; KATNB1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human KATNB1 (NP_005877.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCV | Uniprot ID | Q9BVA0 |
Uniprot Id
Q9BVA0
Target Species
Human
Target Name
KATNB1
Target Full Name
Katanin p80 WD40 repeat-containing subunit B1
Target Function
Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor proteins. This transport is required for axonal growth.
Target Involvement
Lissencephaly 6, with microcephaly (LIS6)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
WD repeat KATNB1 family
Target Synonyms
KAT; Katanin (80 kDa); Katanin p80 (WD repeat containing) subunit B 1; Katanin p80 subunit B 1 ; Katanin p80 subunit B1; Katanin p80 WD40-containing subunit B1; katnb1; KTNB1_HUMAN; OTTHUMP00000164672; p80 katanin
Target Background
Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family of ATPases.
Notification