-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 488-647 of human KCND1 (NP_004970.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 488-647 of human KCND1 (NP_004970.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04903A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCND1 |
| Target Synonyms | KV4.1; KCND1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, 293T, BxPC-3, Mouse brain, Mouse pancreas, Rat pancreas, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 488-647 of human KCND1 (NP_004970.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL | Uniprot ID | Q9NSA2 |
Uniprot Id
Q9NSA2
Target Species
Human
Target Name
KCND1
Target Full Name
A-type voltage-gated potassium channel KCND1
Target Function
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, dendrite.
Target Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.1/KCND1 sub-subfamily
Target Tissue Specificity
Widely expressed. Highly expressed in brain, in particular in cerebellum and thalamus; detected at lower levels in the other parts of the brain.
Target Research Area
Neuroscience
Target Synonyms
Kcnd1; KCND1_HUMAN; Kv4.1; mShal; OTTHUMP00000025805; OTTHUMP00000025806; Potassium voltage gated channel Shal related subfamily member 1; Potassium voltage gated channel subfamily D member 1; Potassium voltage-gated channel subfamily D member 1; Shal type potassium channel; Voltage gated potassium channel Kv4.1; Voltage gated potassium channel subunit Kv4.1; Voltage-gated potassium channel subunit Kv4.1
Target Background
This gene encodes a multipass membrane protein that comprises the pore subunit of the voltage-gated A-type potassium channel, which functions in the repolarization of membrane action potentials. Activity of voltage-gated potassium channels is important in a number of physiological processes, among them the regulation of neurotransmitter release, heart rate, insulin secretion, and smooth muscle contraction.
Notification