-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCND3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 521-655 of human KCND3 (NP_004971.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KCND3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 521-655 of human KCND3 (NP_004971.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11788A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCND3 |
| Target Synonyms | KV4.3; SCA19; SCA22; BRGDA9; KCND3L; KCND3S; KSHIVB; KCND3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, A-549, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 521-655 of human KCND3 (NP_004971.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL | Uniprot ID | Q9UK17 |
Uniprot Id
Q9UK17
Target Species
Human
Target Name
KCND3
Target Full Name
A-type voltage-gated potassium channel KCND3
Target Function
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Target Involvement
Spinocerebellar ataxia 19 (SCA19); Brugada syndrome 9 (BRGDA9)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell projection, dendrite.
Target Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.3/KCND3 sub-subfamily
Target Tissue Specificity
Highly expressed in heart and brain, in particular in cortex, cerebellum, amygdala and caudate nucleus. Detected at lower levels in liver, skeletal muscle, kidney and pancreas. Isoform 1 predominates in most tissues. Isoform 1 and isoform 2 are detected a
Target Synonyms
KCND3; Potassium voltage-gated channel subfamily D member 3; Voltage-gated potassium channel subunit Kv4.3
Target Background
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene.
Notification