-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNE4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 108-221 of human KCNE4 (NP_542402.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNE4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 108-221 of human KCNE4 (NP_542402.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02227A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNE4 |
| Target Synonyms | MIRP3; KCNE4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 108-221 of human KCNE4 (NP_542402.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YMKSKRREKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS | Uniprot ID | Q8WWG9 |
Uniprot Id
Q8WWG9
Target Species
Human
Target Name
KCNE4
Target Full Name
Potassium voltage-gated channel subfamily E member 4
Target Function
Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. May associate with KCNQ1/KVLTQ1 and inhibit potassium current.
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Protein Families
Potassium channel KCNE family
Target Tissue Specificity
Predominantly expressed in embryo and adult uterus. Low expression found in kidney, small intestine, lung and heart.
Target Synonyms
KCNE4; Potassium voltage-gated channel subfamily E member 4; MinK-related peptide 3; Minimum potassium ion channel-related peptide 3; Potassium channel subunit beta MiRP3
Target Background
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a type I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate the gating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the embryo and in adult uterus.
Notification