-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNH2 (NP_000229.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KCNH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNH2 (NP_000229.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04221A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNH2 |
| Target Synonyms | ERG1; HERG; LQT2; SQT1; ERG-1; H-ERG; HERG1; Kv11.1; KCNH2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562, MCF7, Mouse brain, SH-SY5Y, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNH2 (NP_000229.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSS | Uniprot ID | Q12809 |
Uniprot Id
Q12809
Target Species
Human
Target Name
KCNH2
Target Full Name
Voltage-gated inwardly rectifying potassium channel KCNH2
Target Function
Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr).; Has no channel activity by itself, but modulates channel characteristics by forming heterotetramers with other isoforms which are retained intracellularly and undergo ubiquitin-dependent degradation.; Has no channel activity by itself, but modulates channel characteristics by forming heterotetramers with other isoforms which are retained intracellularly and undergo ubiquitin-dependent degradation.
Target Involvement
Long QT syndrome 2 (LQT2); Short QT syndrome 1 (SQT1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Potassium channel family, H (Eag) (TC 1.A.1.20) subfamily, Kv11.1/KCNH2 sub-subfamily
Target Tissue Specificity
Highly expressed in heart and brain. Isoforms USO are frequently overexpressed in cancer cells.
Target Synonyms
ERG1; HERG; LQT2; SQT1; ERG-1; H-ERG; HERG1; Kv11.1; KCNH2
Target Background
This gene encodes a component of a voltage-activated potassium channel found in cardiac muscle, nerve cells, and microglia. Four copies of this protein interact with one copy of the KCNE2 protein to form a functional potassium channel. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified.
Notification