-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNJ10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ10 (NP_002232.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNJ10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ10 (NP_002232.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00914A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNJ10 |
| Target Synonyms | KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN; KCNJ10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, MCF7, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ10 (NP_002232.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQ | Uniprot ID | P78508 |
Uniprot Id
P78508
Target Species
Human
Target Name
KCNJ10
Target Full Name
ATP-sensitive inward rectifier potassium channel 10
Target Function
May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
Target Involvement
Seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SESAMES)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Basolateral cell membrane.
Target Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
Target Tissue Specificity
Expressed in kidney (at protein level).
Target Research Area
Transport
Target Synonyms
KCNJ10; ATP-sensitive inward rectifier potassium channel 10; ATP-dependent inwardly rectifying potassium channel Kir4.1; Inward rectifier K(+ channel Kir1.2; Potassium channel, inwardly rectifying subfamily J member 10
Target Background
This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.
Notification