-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNJ5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ5 (NP_000881.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNJ5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ5 (NP_000881.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03129A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNJ5 |
| Target Synonyms | CIR; GIRK4; KATP1; LQT13; KIR3.4; KCNJ5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ5 (NP_000881.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTI | Uniprot ID | P48544 |
Uniprot Id
P48544
Target Species
Human
Target Name
KCNJ5
Target Full Name
G protein-activated inward rectifier potassium channel 4
Target Function
This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
Target Involvement
Long QT syndrome 13 (LQT13); Hyperaldosteronism, familial, 3 (HALD3)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ5 subfamily
Target Tissue Specificity
Islets, exocrine pancreas and heart. Expressed in the adrenal cortex, particularly the zona glomerulosa.
Target Synonyms
KCNJ5; GIRK4; G protein-activated inward rectifier potassium channel 4; GIRK-4; Cardiac inward rectifier; CIR; Heart KATP channel; Inward rectifier K(+ channel Kir3.4; IRK-4; KATP-1; Potassium channel, inwardly rectifying subfamily J member 5
Target Background
This gene encodes an integral membrane protein which belongs to one of seven subfamilies of inward-rectifier potassium channel proteins called potassium channel subfamily J. The encoded protein is a subunit of the potassium channel which is homotetrameric. It is controlled by G-proteins and has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Naturally occurring mutations in this gene are associated with aldosterone-producing adenomas.
Notification