-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNJ9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 324-393 of human KCNJ9 (NP_004974.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNJ9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 324-393 of human KCNJ9 (NP_004974.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00913A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNJ9 |
| Target Synonyms | GIRK3; KIR3.3; KCNJ9 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 324-393 of human KCNJ9 (NP_004974.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV | Uniprot ID | Q92806 |
Uniprot Id
Q92806
Target Species
Human
Target Name
KCNJ9
Target Full Name
G protein-activated inward rectifier potassium channel 3
Target Function
This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ9 subfamily
Target Synonyms
KCNJ9; GIRK3; G protein-activated inward rectifier potassium channel 3; GIRK-3; Inward rectifier K(+ channel Kir3.3; Potassium channel, inwardly rectifying subfamily J member 9
Target Background
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex.
Notification