-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNK10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 384-543 of human KCNK10 (NP_612191.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNK10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 384-543 of human KCNK10 (NP_612191.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02024A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNK10 |
| Target Synonyms | TREK2; TREK-2; K2p10.1; PPP1R97; KCNK10 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 384-543 of human KCNK10 (NP_612191.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN | Uniprot ID | P57789 |
Uniprot Id
P57789
Target Species
Human
Target Name
KCNK10
Target Full Name
Potassium channel subfamily K member 10
Target Function
Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Target Tissue Specificity
Abundantly expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine. Isoform b is strongly expressed in kidney (primarily in the proximal tubule) and pancreas, whereas isoform c is abundantly expressed in brain.
Target Synonyms
KCNK10; TREK2; Potassium channel subfamily K member 10; Outward rectifying potassium channel protein TREK-2; TREK-2 K(+ channel subunit
Target Background
The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Notification