Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNK9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-374 of human KCNK9 (NP_001269463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNK9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-374 of human KCNK9 (NP_001269463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06319A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNK9 |
| Target Synonyms | KT3.2; TASK3; BIBARS; K2p9.1; TASK-3; TASK32; KCNK9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse large intestine, Mouse pancreas, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 265-374 of human KCNK9 (NP_001269463.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV | Uniprot ID | Q9NPC2 |
Uniprot Id
Q9NPC2
Target Species
Human
Target Name
KCNK9
Target Full Name
Potassium channel subfamily K member 9
Target Function
pH-dependent, voltage-insensitive, background potassium channel protein.
Target Involvement
Birk-Barel mental retardation dysmorphism syndrome (BIBAS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Target Tissue Specificity
Mainly found in the cerebellum. Also found in adrenal gland, kidney and lung.
Target Synonyms
KCNK9; TASK3; Potassium channel subfamily K member 9; Acid-sensitive potassium channel protein TASK-3; TWIK-related acid-sensitive K(+ channel 3; Two pore potassium channel KT3.2; Two pore K(+ channel KT3.2
Target Background
This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel dysmorphism syndrome. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
