Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNMB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-194 of human KCNMB2 (NP_005823.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNMB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-194 of human KCNMB2 (NP_005823.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06454A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNMB2 |
| Target Synonyms | KCNMB2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, Mouse lung, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 68-194 of human KCNMB2 (NP_005823.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSN | Uniprot ID | Q9Y691 |
Uniprot Id
Q9Y691
Target Species
Human
Target Name
KCNMB2
Target Full Name
Calcium-activated potassium channel subunit beta-2
Target Function
Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Acts as a negative regulator that confers rapid and complete inactivation of KCNMA1 channel complex. May participate in KCNMA1 inactivation in chromaffin cells of the adrenal gland or in hippocampal CA1 neurons.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
KCNMB (TC 8.A.14.1) family, KCNMB2 subfamily
Target Tissue Specificity
Expressed in kidney, heart and brain. Highly expressed in ovary. Expressed at low level in other tissues.
Target Synonyms
2700049B16Rik; 3110031N04Rik; BK channel subunit beta 2; BK channel subunit beta-2; BKbeta2; Calcium activated potassium channel subfamily M subunit beta 2; Calcium activated potassium channel subunit beta 2; Calcium-activated potassium channel; Calcium-activated potassium channel subunit beta-2; Charybdotoxin receptor subunit beta 2; Charybdotoxin receptor subunit beta-2; Hbeta2; Hbeta3; K(VCA)beta-2; K(VCA)beta2; KCMB2_HUMAN; KCNMB 2; Kcnmb2; Large conductance Ca2+ activated K+ channel beta2 subunit; Large conductance calcium activated potassium channel beta 2 subunit; Maxi K channel subunit beta 2; Maxi K channel subunit beta-2; MaxiK channel beta 2 subunit; MGC22431; MGC57945; Potassium large conductance calcium activated channel subfamily M beta member 2; Slo-beta-2; Slobeta2; subfamily M subunit beta-2
Target Background
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
