Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KCNN1 (NP_002239.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KCNN1 (NP_002239.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01005A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNN1 |
| Target Synonyms | SK1; hSK1; SKCA1; KCa2.1; KCNN1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Jurkat, Mouse brain, SH-SY5Y, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human KCNN1 (NP_002239.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPRGQPQDQDDDEDDEEDEAGRQRASGKPSNVG | Uniprot ID | Q92952 |
Uniprot Id
Q92952
Target Species
Human
Target Name
KCNN1
Target Full Name
Small conductance calcium-activated potassium channel protein 1
Target Function
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Potassium channel KCNN family, KCa2.1/KCNN1 subfamily
Target Synonyms
KCNN1; SK; Small conductance calcium-activated potassium channel protein 1; SK1; SKCa 1; SKCa1; KCa2.1
Target Background
Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
