-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNN3/SK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 630-730 of human KCNN3/SK3 (NP_002240.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against KCNN3/SK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 630-730 of human KCNN3/SK3 (NP_002240.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-15244A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNN3/SK3 |
| Target Synonyms | SK3; ZLS3; hSK3; SKCA3; KCa2.3; KCNN3/SK3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 630-730 of human KCNN3/SK3 (NP_002240.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSS | Uniprot ID | Q9UGI6 |
Uniprot Id
Q9UGI6
Target Species
Human
Target Name
KCNN3
Target Full Name
Small conductance calcium-activated potassium channel protein 3
Target Function
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Potassium channel KCNN family, KCa2.3/KCNN3 subfamily
Target Synonyms
KCNN3; K3; Small conductance calcium-activated potassium channel protein 3; SK3; SKCa 3; SKCa3; KCa2.3
Target Background
Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. This gene belongs to the KCNN family of potassium channels. It encodes an integral membrane protein that forms a voltage-independent calcium-activated channel, which is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. This gene contains two CAG repeat regions in the coding sequence. It was thought that expansion of one or both of these repeats could lead to an increased susceptibility to schizophrenia or bipolar disorder, but studies indicate that this is probably not the case. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification