Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNQ2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 466-665 of human KCNQ2 (NP_742105.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNQ2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 466-665 of human KCNQ2 (NP_742105.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09936A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNQ2 |
| Target Synonyms | EBN; BFNC; DEE7; EBN1; ENB1; HNSPC; KV7.2; KCNA11; KCNQ2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 466-665 of human KCNQ2 (NP_742105.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEASLPGEDIVDDKSCPCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPAITDKDRTKGPAEAELPEDPSMMGRLGKVEKQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPE | Uniprot ID | O43526 |
Uniprot Id
O43526
Target Species
Human
Target Name
KCNQ2
Target Full Name
Potassium voltage-gated channel subfamily KQT member 2
Target Synonyms
BFNC; BFNS1; EBN 1; EBN; EBN1; EIEE7; ENB 1; ENB1; HNSPC; KCNA 11; KCNA11; KCNQ 2; Kcnq2; KCNQ2_HUMAN; KQT like 2 ; KQT-like 2; KV7.2; KVEBN 1; KVEBN1; KvLQT 2; KvLQT2; Neuroblastoma specific potassium channel alpha subunit KvLQT2 ; Neuroblastoma specific potassium channel protein; Neuroblastoma specific potassium channel subunit alpha; Neuroblastoma specific potassium channel subunit alpha KvLQT2; Neuroblastoma-specific potassium channel subunit alpha KvLQT2; OTTHUMP00000031681; OTTHUMP00000031682; OTTHUMP00000031684; OTTHUMP00000031685; OTTHUMP00000031686; OTTHUMP00000031687; OTTHUMP00000031689; Potassium voltage gated channel KQT like protein 2 ; Potassium voltage gated channel KQT like subfamily member 2; Potassium voltage gated channel subfamily KQT member 2; Potassium voltage-gated channel subfamily KQT member 2; Voltage gated potassium channel subunit Kv7.2; Voltage-gated potassium channel subunit Kv7.2
Target Background
The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by this gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in this gene are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1). At least five transcript variants encoding five different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
