-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 365-515 of human KDM1 (NP_055828.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against KDM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 365-515 of human KDM1 (NP_055828.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-12036A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM1 |
| Target Synonyms | AOF2; CPRF; KDM1; LSD1; BHC110 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7 | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 365-515 of human KDM1 (NP_055828.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANP | Uniprot ID | O60341 |
Uniprot Id
O60341
Target Species
Human
Target Name
KDM1A
Target Full Name
Lysine-specific histone demethylase 1A
Target Function
Histone demethylase that can demethylate both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me. May play a role in the repression of neuronal genes. Alone, it is unable to demethylate H3K4me on nucleosomes and requires the presence of RCOR1/CoREST to achieve such activity. Also acts as a coactivator of androgen receptor (AR)-dependent transcription, by being recruited to AR target genes and mediating demethylation of H3K9me, a specific tag for epigenetic transcriptional repression. The presence of PRKCB in AR-containing complexes, which mediates phosphorylation of 'Thr-6' of histone H3 (H3T6ph), a specific tag that prevents demethylation H3K4me, prevents H3K4me demethylase activity of KDM1A. Demethylates di-methylated 'Lys-370' of p53/TP53 which prevents interaction of p53/TP53 with TP53BP1 and represses p53/TP53-mediated transcriptional activation. Demethylates and stabilizes the DNA methylase DNMT1. Required for gastrulation during embryogenesis. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Effector of SNAI1-mediated transcription repression of E-cadherin/CDH1, CDN7 and KRT8. Required for the maintenance of the silenced state of the SNAI1 target genes E-cadherin/CDH1 and CDN7.
Target Involvement
Cleft palate, psychomotor retardation, and distinctive facial features (CPRF)
Target Subcellular Location
Nucleus.
Target Protein Families
Flavin monoamine oxidase family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
Amine oxidase (flavin containing) domain 2; Amine oxidase, flavin containing, 2; AOF2; BHC110 ; BRAF35 HDAC complex protein BHC110; BRAF35-HDAC complex protein BHC110; BRAF35/HDAC complex, 110-kD subunit; CPRF; EC1; FAD binding protein BRAF35 HDAC complex, 110 kDa subunit; Flavin-containing amine oxidase domain-containing protein 2; KDM 1; KDM1; Kdm1a; KDM1A_HUMAN; KIAA0601; LSD 1; LSD1; Lysine (K) specific demethylase 1; Lysine (K) specific demethylase 1A; Lysine demethylase 1A; Lysine specific histone demethylase 1; Lysine specific histone demethylase 1A; Lysine-specific demethylase 1; Lysine-specific demethylase 1A; Lysine-specific histone demethylase 1A
Target Background
This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.
Notification