-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KDM2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10020A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM2B |
| Target Synonyms | CXXC2; Fbl10; PCCX2; FBXL10; JHDM1B; KDM2B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSIN | Uniprot ID | Q8NHM5 |
Uniprot Id
Q8NHM5
Target Species
Human
Target Name
KDM2B
Target Full Name
Lysine-specific demethylase 2B
Target Function
Histone demethylase that demethylates 'Lys-4' and 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation. May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex (Probable).
Target Subcellular Location
Nucleus, nucleolus. Nucleus. Chromosome.
Target Protein Families
JHDM1 histone demethylase family
Target Synonyms
[Histone-H3]-lysine-36 demethylase 1B; CXXC-type zinc finger protein 2; CXXC2; F box and leucine rich repeat protein 10; F box protein FBL10; F-box and leucine-rich repeat protein 10; F-box protein FBL10; F-box/LRR-repeat protein 10; Fbl10; FBXL10; JEMMA (Jumonji domain EMSY interactor methyltransferase motif) protein; JHDM1B; JmjC domain-containing histone demethylation protein 1B; Jumonji C domain containing histone demethylase 1B; Jumonji domain-containing EMSY-interactor methyltransferase motif protein; kdm2b; KDM2B_HUMAN; Lysine (K) specific demethylase 2B; Lysine-specific demethylase 2B; PCCX2; Protein containing CXXC domain 2; Protein JEMMA; Protein-containing CXXC domain 2
Target Background
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.
Notification