-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KHSRP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human KHSRP (Q92945) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against KHSRP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human KHSRP (Q92945) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-14012A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KHSRP |
| Target Synonyms | p75; FBP2; KSRP; FUBP2; KHSRP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, C2C12, Hep G2, Mouse brain | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human KHSRP (Q92945). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI | Uniprot ID | Q92945 |
Uniprot Id
Q92945
Target Species
Human
Target Name
KHSRP
Target Full Name
Far upstream element-binding protein 2
Target Function
Binds to the dendritic targeting element and may play a role in mRNA trafficking. Part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. Mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
KHSRP family
Target Tissue Specificity
Detected in neural and non-neural cell lines.
Target Synonyms
Far upstream element-binding protein 2; FBP2; FUBP2; FUBP2_HUMAN; FUSE binding protein 2; FUSE-binding protein 2; KH type splicing regulatory protein (FUSE binding protein 2); KH type splicing regulatory protein; KH type-splicing regulatory protein; KHSRP; KSRP; p75
Target Background
The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).
Notification