Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIAA0196 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-530 of human KIAA0196 (NP_055661.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KIAA0196 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-530 of human KIAA0196 (NP_055661.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02309A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIAA0196 |
| Target Synonyms | RTSC; SPG8; RTSC1; KIAA0196 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-530 of human KIAA0196 (NP_055661.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TADSACDPNNKRLRQIKDQILTDSRYNPRILFQLLLDTAQFEFILKEMFKQMLSEKQTKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREISKQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKF | Uniprot ID | Q12768 |
Uniprot Id
Q12768
Target Species
Human
Target Name
WASHC5
Target Full Name
WASH complex subunit 5
Target Function
Acts as a component of the WASH core complex that functions as a nucleation-promoting factor (NPF) at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during endosome sorting. May be involved in axonal outgrowth. Involved in cellular localization of ADRB2. Involved in cellular trafficking of BLOC-1 complex cargos such as ATP7A and VAMP7.
Target Involvement
Spastic paraplegia 8, autosomal dominant (SPG8); Ritscher-Schinzel syndrome 1 (RTSC1)
Target Subcellular Location
Cytoplasm, cytosol. Endoplasmic reticulum. Early endosome.
Target Protein Families
Strumpellin family
Target Tissue Specificity
Expressed ubiquitously.
Target Synonyms
KIAA0196; SPG8; STRUM_HUMAN; WASH complex subunit strumpellin
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
