Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIAA1456 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human KIAA1456 (NP_065895.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against KIAA1456 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human KIAA1456 (NP_065895.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08248A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIAA1456 |
| Target Synonyms | KIAA1456; C8orf79; TRM9L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Bewo, Mouse brain, Rat uterus, U266 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human KIAA1456 (NP_065895.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VWAMEQKNRHFEKQDVLVPWNRALCSQLFSESSQSGRKRQCGYPERGHPYHPPCSECSCSVCFKEQCGSKRSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSW | Uniprot ID | Q9P272 |
Uniprot Id
Q9P272
Target Species
Human
Target Name
TRMT9B
Target Full Name
Probable tRNA methyltransferase 9B
Target Function
May modifie wobble uridines in specific arginine and glutamic acid tRNAs. Acts as a tumor suppressor by promoting the expression of LIN9.
Target Protein Families
Methyltransferase superfamily
Target Tissue Specificity
Down-regulated in breast, bladder, colorectal, cervix and testicular carcinomas.
Target Synonyms
TRMT9B; C8orf79; KIAA1456; TRM9L; Probable tRNA methyltransferase 9B; Probable tRNA methyltransferase 9-like protein; EC 2.1.1.-
Target Background
Enables tRNA methyltransferase activity. Predicted to be involved in tRNA wobble uridine modification. Predicted to be active in cytoplasm and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
