Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 810-960 of human KIF1C (NP_006603.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIF1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 810-960 of human KIF1C (NP_006603.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08820A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF1C |
| Target Synonyms | SAX2; LTXS1; SATX2; SPAX2; SPG58; KIF1C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2, K-562, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 810-960 of human KIF1C (NP_006603.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEGGGAGSGGGSEEGARGAEVEDLRAHIDKLTGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEEAAPSDRMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGG | Uniprot ID | O43896 |
Uniprot Id
O43896
Target Species
Human
Target Name
KIF1C
Target Full Name
Kinesin-like protein KIF1C
Target Function
Motor required for the retrograde transport of Golgi vesicles to the endoplasmic reticulum. Has a microtubule plus end-directed motility.
Target Involvement
Spastic ataxia 2, autosomal recessive (SPAX2)
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Unc-104 subfamily
Target Tissue Specificity
Expressed in all tissues examined, with most abundant expression in heart and skeletal muscle.
Target Synonyms
Kif1c; KIF1C_HUMAN; Kinesin family member 1C; Kinesin-like protein KIF1C; LTXS1
Target Background
The protein encoded by this gene is a member of the kinesin-like protein family. The family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. Mutations in this gene are a cause of spastic ataxia 2, autosomal recessive.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
