-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human KIF2A (NP_004511.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIF2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human KIF2A (NP_004511.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00313A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF2A |
| Target Synonyms | HK2; KIF2; CDCBM3; KIF2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Jurkat, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human KIF2A (NP_004511.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPID | Uniprot ID | O00139 |
Uniprot Id
O00139
Target Species
Human
Target Name
KIF2A
Target Full Name
Kinesin-like protein KIF2A
Target Function
Plus end-directed microtubule-dependent motor required for normal brain development. May regulate microtubule dynamics during axonal growth. Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate. Required for normal spindle dynamics during mitosis. Promotes spindle turnover. Implicated in formation of bipolar mitotic spindles. Has microtubule depolymerization activity.
Target Involvement
Cortical dysplasia, complex, with other brain malformations 3 (CDCBM3)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle pole. Cytoplasm, cytoskeleton, spindle. Note=Localized to the spindle microtubules and spindle poles from prophase to metaphase. Efficient targeting to spindle microtubules and spindle poles requires the kinase activity of PLK1. Recruited to mitotic spindles by interaction with PSRC1.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, MCAK/KIF2 subfamily
Target Synonyms
CDCBM3; HK2; KIF2; KIF2A; KIF2A_HUMAN; Kinesin 2; Kinesin heavy chain 2; Kinesin heavy chain member 2; Kinesin heavy chain member 2A ; Kinesin like protein KIF2A; Kinesin-2; Kinesin-like protein KIF2A; KNS2; M Kinesin
Target Background
The protein encoded by this gene is a plus end-directed motor required for normal mitotic progression. The encoded protein is required for normal spindle activity during mitosis and is necessary for normal brain development. Several transcript variants encoding different isoforms have been found for this gene.
Notification