Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 544-673 of human KIF2B (NP_115948.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIF2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 544-673 of human KIF2B (NP_115948.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09477A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF2B |
| Target Synonyms | KIF2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse testis, Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 544-673 of human KIF2B (NP_115948.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLSILEQKIDALTEIQKKLKLLLADLHVKSKVE | Uniprot ID | Q8N4N8 |
Uniprot Id
Q8N4N8
Target Species
Human
Target Name
KIF2B
Target Full Name
Kinesin-like protein KIF2B
Target Function
Plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. Has microtubule depolymerization activity. Plays a role in chromosome congression.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Chromosome, centromere, kinetochore. Note=Association with kinetochore is transient.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, MCAK/KIF2 subfamily
Target Tissue Specificity
Highest level in lung. High level in ovary, moderate levels in heart, kidney, placenta, skeletal muscle and spleen (at protein level). Pancreas and spleen express a shorter isoform (at protein level).
Target Synonyms
KIF2BKinesin-like protein KIF2B
Target Background
Predicted to enable microtubule binding activity and microtubule motor activity. Involved in metaphase plate congression; microtubule depolymerization; and regulation of chromosome segregation. Located in intercellular bridge; mitotic spindle; and nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
