Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-699 of human KIF3A (Q9Y496) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against KIF3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-699 of human KIF3A (Q9Y496) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13255A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF3A |
| Target Synonyms | FLA10; KLP-20; KIF3A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-699 of human KIF3A (Q9Y496). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ | Uniprot ID | Q9Y496 |
Uniprot Id
Q9Y496
Target Species
Human
Target Name
KIF3A
Target Full Name
Kinesin-like protein KIF3A
Target Function
Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. Plays a role in primary cilia formation. Plays a role in centriole cohesion and subdistal appendage organization and function. Regulates the formation of the subdistal appendage via recruitment of DCTN1 to the centriole. Also required for ciliary basal feet formation and microtubule anchoring to mother centriole.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, cilium. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Kinesin II subfamily
Target Synonyms
FLA10; KLP-20; KIF3A
Target Background
Enables protein phosphatase binding activity; small GTPase binding activity; and spectrin binding activity. Involved in protein localization to cell junction and protein transport. Located in centriole and centrosome. Part of kinesin II complex. Colocalizes with spindle microtubule.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
