-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KIF5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09804A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF5A |
| Target Synonyms | NKHC; ALS25; MY050; NEIMY; SPG10; D12S1889; KIF5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS | Uniprot ID | Q12840 |
Uniprot Id
Q12840
Target Species
Human
Target Name
KIF5A
Target Full Name
Kinesin heavy chain isoform 5A
Target Function
Microtubule-dependent motor required for slow axonal transport of neurofilament proteins (NFH, NFM and NFL). Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a ZFYVE27-dependent manner. The ZFYVE27-KIF5A complex contributes to the vesicular transport of VAPA, VAPB, SURF4, RAB11A, RAB11B and RTN3 proteins in neurons. Required for anterograde axonal transportation of MAPK8IP3/JIP3 which is essential for MAPK8IP3/JIP3 function in axon elongation.
Target Involvement
Spastic paraplegia 10, autosomal dominant (SPG10); Myoclonus, intractable, neonatal (NEIMY)
Target Subcellular Location
Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton. Perikaryon.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Kinesin subfamily
Target Tissue Specificity
Distributed throughout the CNS but is highly enriched in subsets of neurons.
Target Synonyms
D12S1889; KIF 5A; Kif5a; KIF5A_HUMAN; Kinesin family member 5A; Kinesin heavy chain isoform 5A; Kinesin Heavy Chain Neuron Specific; Kinesin heavy chain neuron-specific 1; MY050; Neuronal kinesin heavy chain; NKHC 1; NKHC; SPG 10
Target Background
This gene encodes a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
Notification