-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIFAP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 675-792 of human KIFAP3 (Q92845) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KIFAP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 675-792 of human KIFAP3 (Q92845) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13938A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIFAP3 |
| Target Synonyms | FLA3; KAP3; SMAP; KAP-1; KAP-3; Smg-GDS; dJ190I16.1; KIFAP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 675-792 of human KIFAP3 (Q92845). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS | Uniprot ID | Q92845 |
Uniprot Id
Q92845
Target Species
Human
Target Name
KIFAP3
Target Full Name
Kinesin-associated protein 3
Target Function
Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Binds to the tail domain of the KIF3A/KIF3B heterodimer to form a heterotrimeric KIF3 complex and may regulate the membrane binding of this complex.
Target Synonyms
FLJ22818; KAP 3; KAP-3; KAP3; KIF3AP; KIFA3_HUMAN; Kifap3; Kinesin associated protein 3; Kinesin-associated protein 3; SMAP; Smg GDS; Smg GDS associated protein; Smg GDS-associated protein
Target Background
The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes. The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein. Several transcript variants encoding different isoforms have been found for this gene.
Notification