-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIRREL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human KIRREL2 (NP_954649.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KIRREL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human KIRREL2 (NP_954649.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03451A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIRREL2 |
| Target Synonyms | NLG1; NEPH3; FILTRIN; KIRREL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human KIRREL2 (NP_954649.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAIT | Uniprot ID | Q6UWL6 |
Uniprot Id
Q6UWL6
Target Species
Human
Target Name
KIRREL2
Target Full Name
Kin of IRRE-like protein 2
Target Function
May regulate basal insulin secretion.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily
Target Tissue Specificity
Highly expressed in beta-cells of the pancreatic islets.
Target Synonyms
FILTRIN ; Kin of IRRE like 2 (Drosophila); Kin of IRRE-like protein 2; Kin of irregular chiasm like 2; Kin of irregular chiasm-like protein 2; KIRR2_HUMAN; KIRREL2; NEPH3 ; Nephrin like 3; nephrin-like gene 1; Nephrin-like protein 3; NLG1
Target Background
This gene encodes a type I transmembrane protein and member of the immunoglobulin superfamily of cell adhesion molecules. The encoded protein localizes to adherens junctions in pancreatic beta cells and regulates insulin secretion. Autoantibodies against the encoded protein have been detected in serum from patients with type 1 diabetes. This gene may also play a role in glomerular development and decreased expression of this gene has been observed in human glomerular diseases. This gene and the related opposite-strand gene nephrin (GeneID: 527362) are regulated by a bidirectional promoter.
Notification