Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human KLC3 (NP_803136.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human KLC3 (NP_803136.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05708A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLC3 |
| Target Synonyms | KLC2; KLCt; KLC2L; KNS2B; KLC3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human KLC3 (NP_803136.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEE | Uniprot ID | Q6P597 |
Uniprot Id
Q6P597
Target Species
Human
Target Name
KLC3
Target Full Name
Kinesin light chain 3
Target Function
Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Kinesin light chain family
Target Research Area
Signal Transduction
Target Synonyms
Kinesin light chain 2; Kinesin light chain 3; KLC2 ; KLC2 like; KLC2-like; KLC2L ; KLC3; KLC3_HUMAN; KLCt ; KNS2B
Target Background
This gene encodes a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
