-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 211-311 of human KLF1 (NP_006554.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 211-311 of human KLF1 (NP_006554.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08255A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF1 |
| Target Synonyms | KLF1; EKLF; CDAN4; HBFQTL6; INLU; Kruppel like factor 1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 211-311 of human KLF1 (NP_006554.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYAC | Uniprot ID | Q13351 |
Uniprot Id
Q13351
Target Species
Human
Target Name
KLF1
Target Full Name
Krueppel-like factor 1
Target Function
Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.
Target Involvement
Anemia, congenital dyserythropoietic, 4 (CDAN4)
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CDAN4; EKLF; EKLF PEN; Erythroid krueppel like transcription factor (EKLF) (Erythroid transcription factor); Erythroid krueppel-like transcription factor; Erythroid Kruppel like factor ; Erythroid specific transcription factor EKLF; HBFQTL6; Human erythroid-specific transcription factor EKLF mRNA complete cds ; INLU; Klf1; KLF1_HUMAN; Krueppel-like factor 1; Kruppel like factor 1 (erythroid)
Target Background
This gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozygous loss-of-function mutations in this gene result in the dominant In(Lu) blood phenotype.
Notification