-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 13-107 of human KLF11 (NP_003588.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLF11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 13-107 of human KLF11 (NP_003588.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04395A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF11 |
| Target Synonyms | FKLF; FKLF1; MODY7; TIEG2; Tieg3; KLF11 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse thymus, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 13-107 of human KLF11 (NP_003588.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCIT | Uniprot ID | O14901 |
Uniprot Id
O14901
Target Species
Human
Target Name
KLF11
Target Full Name
Krueppel-like factor 11
Target Function
Transcription factor. Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling. Induces apoptosis.
Target Involvement
Maturity-onset diabetes of the young 7 (MODY7)
Target Subcellular Location
Nucleus.
Target Protein Families
Sp1 C2H2-type zinc-finger protein family
Target Tissue Specificity
Ubiquitous. Higher expression in erythroid cells.
Target Synonyms
9830142A17; D12Ertd427e; FKLF; FKLF1; Klf11; KLF11_HUMAN; Krueppel like factor 11; Krueppel-like factor 11; Krueppel-like transcription factor 1; MODY7; Tcfcp2l2 ; TGFB Early Growth Response 2; TGFB-inducible early growth response protein 2; TGFB-inducible early growth response protein 2b; TGFB-inducible early growth response protein 3; TIEG 2; TIEG-2; TIEG-3; Tieg2b; Transforming Growth Factor Beta Inducible Early Growth Response 2; Transforming growth factor-beta-inducible early growth response protein 2; Transforming growth factor-beta-inducible early growth response protein 3
Target Background
The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been found for this gene.
Notification