-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human KLF6 (NP_001291.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against KLF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human KLF6 (NP_001291.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08964A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF6 |
| Target Synonyms | GBF; ZF9; BCD1; CBA1; CPBP; PAC1; ST12; COPEB; KLF6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human KLF6 (NP_001291.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVH | Uniprot ID | Q99612 |
Uniprot Id
Q99612
Target Species
Human
Target Name
KLF6
Target Full Name
Krueppel-like factor 6
Target Function
Transcriptional activator. Binds a GC box motif. Could play a role in B-cell growth and development.
Target Involvement
Gastric cancer (GASC); Prostate cancer (PC)
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.
Target Synonyms
B cell derived protein 1; B cell-derived 1; B-cell-derived protein 1; BCD1; CBA1; COPEB; Core promoter element-binding protein; CPBP; GBF; GC rich binding factor; GC rich sites binding factor GBF; GC-rich sites-binding factor GBF; Klf6; KLF6_HUMAN; Krueppel-like factor 6; Krueppel-like factor 6 isoform C; Kruppel like zinc finger protein Zf9; PAC1; Proto-oncogene BCD1; Protooncogene B cell derived 1; ST12; Suppression of tumorigenicity 12 (prostate); Suppressor of tumorigenicity 12 protein; Transcription factor Zf9; Zf9
Target Background
This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis.
Notification