-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLHL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human KLHL3 (NP_059111.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLHL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human KLHL3 (NP_059111.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06051A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLHL3 |
| Target Synonyms | PHA2D; KLHL3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human KLHL3 (NP_059111.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYT | Uniprot ID | Q9UH77 |
Uniprot Id
Q9UH77
Target Species
Human
Target Name
KLHL3
Target Full Name
Kelch-like protein 3
Target Function
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a regulator of ion transport in the distal nephron. The BCR(KLHL3) complex acts by mediating ubiquitination of WNK4, an inhibitor of potassium channel KCNJ1, leading to WNK4 degradation. The BCR(KLHL3) complex also mediates ubiquitination and degradation of CLDN8, a tight-junction protein required for paracellular chloride transport in the kidney.
Target Involvement
Pseudohypoaldosteronism 2D (PHA2D)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytosol.
Target Tissue Specificity
Widely expressed.
Target Synonyms
KLHL3; KIAA1129; Kelch-like protein 3
Target Background
This gene is ubiquitously expressed and encodes a full-length protein which has an N-terminal BTB domain followed by a BACK domain and six kelch-like repeats in the C-terminus. These kelch-like repeats promote substrate ubiquitination of bound proteins via interaction of the BTB domain with the CUL3 (cullin 3) component of a cullin-RING E3 ubiquitin ligase (CRL) complex. Muatations in this gene cause pseudohypoaldosteronism type IID (PHA2D); a rare Mendelian syndrome featuring hypertension, hyperkalaemia and metabolic acidosis. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification