Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLHL7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human KLHL7 (NP_061334.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLHL7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human KLHL7 (NP_061334.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09185A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLHL7 |
| Target Synonyms | CISS3; KLHL6; SBBI26; PERCHING; KLHL7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse brain, Mouse testis, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KLHL7 (NP_061334.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QAEPLIQDNPECLKMVISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFP | Uniprot ID | Q8IXQ5 |
Uniprot Id
Q8IXQ5
Target Species
Human
Target Name
KLHL7
Target Full Name
Kelch-like protein 7
Target Function
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex. The BCR(KLHL7) complex acts by mediating ubiquitination and subsequent degradation of substrate proteins. Probably mediates 'Lys-48'-linked ubiquitination.
Target Involvement
Cold-induced sweating syndrome 3 (CISS3); Retinitis pigmentosa 42 (RP42)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Widely expressed, with highest levels in adult and fetal heart, CNS and adult testis.
Target Synonyms
KLHL7Kelch-like protein 7
Target Background
This gene encodes a BTB-Kelch-related protein. The encoded protein may be involved in protein degradation. Mutations in this gene have been associated with retinitis pigmentosa 42.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
