-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KPNA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KPNA2 (P52292) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KPNA2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KPNA2 (P52292) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16094A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KPNA2 |
| Target Synonyms | QIP2; RCH1; IPOA1; PTAC58; SRP1alpha; SRP1-alpha; KPNA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, A549, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KPNA2 (P52292). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAA | Uniprot ID | P52292 |
Uniprot Id
P52292
Target Species
Human
Target Name
KPNA2
Target Full Name
Importin subunit alpha-1
Target Function
Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
Target Subcellular Location
Cytoplasm. Nucleus.; Endoplasmic reticulum membrane. Golgi apparatus membrane.
Target Protein Families
Importin alpha family
Target Tissue Specificity
Expressed ubiquitously.
Target Synonyms
IMA1_HUMAN; Importin alpha 1; Importin alpha 2; Importin alpha 2 subunit; Importin alpha P1; Importin subunit alpha-1; IPO A1; IPOA 1; IPOA1; Karyopherin alpha 2; Karyopherin alpha 2 RAG cohort 1; Karyopherin alpha 2 subunit; Karyopherin subunit alpha-2; KPNA2; KPNA2 protein; Pendulin; QIP 2; QIP2; RAG cohort 1; RAG cohort protein 1; RCH 1; RCH1; SRP 1; SRP1 alpha; SRP1; SRP1-alpha; SRP1alpha
Target Background
The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination. Alternative splicing results in multiple transcript variants.
Notification