-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KPNA6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 69-169 of human KPNA6 (NP_036448.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KPNA6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 69-169 of human KPNA6 (NP_036448.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15595A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KPNA6 |
| Target Synonyms | IPOA7; KPNA6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 69-169 of human KPNA6 (NP_036448.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAV | Uniprot ID | O60684 |
Uniprot Id
O60684
Target Species
Human
Target Name
KPNA6
Target Full Name
Importin subunit alpha-7
Target Function
Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
Target Protein Families
Importin alpha family
Target Tissue Specificity
Widely expressed.
Target Synonyms
FLJ11249; IMA7_HUMAN; Importin alpha 7 subunit ; Importin alpha S2 ; Importin subunit alpha 7; Importin subunit alpha-7; IPOA 7; IPOA7; Karyopherin alpha 6 ; Karyopherin alpha 6 (importin alpha 7); Karyopherin subunit alpha 6; Karyopherin subunit alpha-6; KPNA 6; KPNA 7; Kpna6; KPNA7; MGC17918; OTTHUMP00000004532
Target Background
Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. The protein encoded by this gene is a member of the importin alpha family.
Notification