Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KRBOX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human KRBOX4 (NP_001123371.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KRBOX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human KRBOX4 (NP_001123371.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03003A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KRBOX4 |
| Target Synonyms | ZNF673; KRBOX4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human KRBOX4 (NP_001123371.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCAGEDRPDVSIFASCILKCCY | Uniprot ID | Q5JUW0 |
Uniprot Id
Q5JUW0
Target Species
Human
Target Name
KRBOX4
Target Full Name
KRAB domain-containing protein 4
Target Synonyms
Protein ZNF673; RP4-733D15.4; zinc finger family member 673 ; ZN673_HUMAN; ZNF673
Target Background
This encodes a zinc finger protein with an N-terminal KRAB (Kruppel-associated) domain found in transcriptional repressors. This gene is located in a region of the X chromosome thought to be involved in nonsyndromic X-linked cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
