-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KRT81 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human KRT81 (NP_002272.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KRT81 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human KRT81 (NP_002272.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09780A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KRT81 |
| Target Synonyms | HB1; K81; Hb-1; KRTHB1; MLN137; ghHkb1; hHAKB2-1; KRT81 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7, Mouse ovary, Mouse testis, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human KRT81 (NP_002272.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEGIGAVNVCVSSSRGGVVCGDLCVSGSRPVTG | Uniprot ID | Q14533 |
Uniprot Id
Q14533
Target Species
Human
Target Name
KRT81
Target Full Name
Keratin, type II cuticular Hb1
Target Involvement
Monilethrix (MNLIX)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Abundantly expressed in the differentiating cortex of growing (anagen) hair. Expression is restricted to the keratinocytes of the hair cortex and is absent from inner root sheath and medulla. Expressed in malignant lymph node tissue in breast carcinoma ti
Target Synonyms
1; basic; ghHb 1; ghHb1; ghHkb 1; ghHKb1; hair; Hair keratin K2.9; Hard keratin type II 1; HB 1; HB1; hHAKB2 1; K2.9; K81; Keratin 81; Keratin; Keratin hair basic 1; Keratin type II cuticular Hb1; Keratin-81; Keratin81; KRT 81; KRT81; KRT81_HUMAN; KRTHB 1; KRTHB1; Metastatic lymph node 137 gene protein; MLN 137; MLN137; type II cuticular Hb1; Type II hair keratin Hb1; Type-II keratin Kb21
Target Background
The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this hair keratin, as well as KRTHB3 and KRTHB6, is found primarily in the hair cortex. Mutations in this gene and KRTHB6 have been observed in patients with a rare dominant hair disease, monilethrix.
Notification