-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KSR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-420 of human KSR1 (NP_055053.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KSR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-420 of human KSR1 (NP_055053.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05265A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KSR1 |
| Target Synonyms | KSR; RSU2; KSR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, Jurkat, Mouse brain, Mouse lung, Mouse spleen, Mouse testis, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 320-420 of human KSR1 (NP_055053.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAH | Uniprot ID | Q8IVT5 |
Uniprot Id
Q8IVT5
Target Species
Human
Target Name
KSR1
Target Full Name
Kinase suppressor of Ras 1
Target Function
Part of a multiprotein signaling complex which promotes phosphorylation of Raf family members and activation of downstream MAP kinases. Independently of its kinase activity, acts as MAP2K1/MEK1 and MAP2K2/MEK2-dependent allosteric activator of BRAF; upon binding to MAP2K1/MEK1 or MAP2K2/MEK2, dimerizes with BRAF and promotes BRAF-mediated phosphorylation of MAP2K1/MEK1 and/or MAP2K2/MEK2. Promotes activation of MAPK1 and/or MAPK3, both in response to EGF and to cAMP. Its kinase activity is unsure. Some protein kinase activity has been detected in vitro, however the physiological relevance of this activity is unknown.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Cell projection, ruffle membrane. Endoplasmic reticulum membrane.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family
Target Research Area
Signal Transduction
Target Synonyms
BKSR 1; BKSR1; dKsr; EK 31; EK31; hb; Kinase suppressor of Ras 1; Kinase suppressor of ras; KSR 1; KSR; KSR1; KSR1_HUMAN; Positive Ras signaling mediator family member (86.4 kD); Positive Ras signaling mediator family member; RSU 2; RSU2; SR 31; SR31; Suppressor of activated let 60 Ras SUR3; Suppressor of Ras1 31
Target Background
Enables 14-3-3 protein binding activity; ATP binding activity; and protein C-terminus binding activity. Involved in positive regulation of MAPK cascade. Located in endoplasmic reticulum and membrane. Part of protein-containing complex. Implicated in breast adenocarcinoma. Biomarker of breast cancer.
Notification