Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KTN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KTN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03636A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KTN1 |
| Target Synonyms | CG1; KNT; MU-RMS-40.19; KTN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, A673, MCF7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV | Uniprot ID | Q86UP2 |
Uniprot Id
Q86UP2
Target Species
Human
Target Name
KTN1
Target Full Name
Kinectin
Target Function
Receptor for kinesin thus involved in kinesin-driven vesicle motility. Accumulates in integrin-based adhesion complexes (IAC) upon integrin aggregation by fibronectin.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein. Note=Vesicle membrane protein anchored to the endoplasmic reticulum.
Target Protein Families
Kinectin family
Target Tissue Specificity
High levels in peripheral blood lymphocytes, testis and ovary, lower levels in spleen, thymus, prostate, small intestine and colon.
Target Synonyms
CG-1 antigen; CG1; CG1 antigen; KIAA0004; Kinectin; Kinesin receptor; Ktn1; KTN1_HUMAN; MU-RMS-40.19
Target Background
This gene encodes an integral membrane protein that is a member of the kinectin protein family. The encoded protein is primarily localized to the endoplasmic reticulum membrane. This protein binds kinesin and may be involved in intracellular organelle motility. This protein also binds translation elongation factor-delta and may be involved in the assembly of the elongation factor-1 complex. Alternate splicing results in multiple transcript variants of this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
