-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ku70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 505-609 of human Ku70 (NP_001275905.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Ku70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 505-609 of human Ku70 (NP_001275905.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08369A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ku70 |
| Target Synonyms | ML8; KU70; TLAA; CTC75; CTCBF; G22P1; 70 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 505-609 of human Ku70 (NP_001275905.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD | Uniprot ID | P12956 |
Uniprot Id
P12956
Target Species
Human
Target Name
XRCC6
Target Full Name
X-ray repair cross-complementing protein 6
Target Function
Single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA non-homologous end joining (NHEJ) by recruiting DNA-PK to DNA. Required for double-strand break repair and V(D)J recombination. Also has a role in chromosome translocation. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. During NHEJ, the XRCC5-XRRC6 dimer performs the recognition step: it recognizes and binds to the broken ends of the DNA and protects them from further resection. Binding to DNA may be mediated by XRCC6. The XRCC5-XRRC6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5-XRRC6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. 5'-dRP lyase activity allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5-XRRC6 dimer together with APEX1 acts as a negative regulator of transcription. In association with NAA15, the XRCC5-XRRC6 dimer binds to the osteocalcin promoter and activates osteocalcin expression. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Ku70 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
5''-deoxyribose-5-phosphate lyase Ku70; 5''-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP dependent DNA helicase 2 subunit 1; ATP dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22P1; Ku 70; Ku autoantigen p70 subunit; Ku autoantigen, 70kDa; Ku p70; Ku70; Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa; Kup70; Lupus Ku autoantigen protein p70; ML8; Thyroid autoantigen 70kD (Ku antigen); Thyroid autoantigen; Thyroid lupus autoantigen; Thyroid lupus autoantigen p70; Thyroid-lupus autoantigen; TLAA; X ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair cross-complementing protein 6; XRCC 6; Xrcc6; XRCC6_HUMAN
Target Background
The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
Notification