Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAGE3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human LAGE3 (NP_006005.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LAGE3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human LAGE3 (NP_006005.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07510A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAGE3 |
| Target Synonyms | CVG5; ESO3; Pcc1; ITBA2; GAMOS2; DXS9879E; DXS9951E; LAGE3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, HepG2, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human LAGE3 (NP_006005.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR | Uniprot ID | Q14657 |
Uniprot Id
Q14657
Target Species
Human
Target Name
LAGE3
Target Full Name
EKC/KEOPS complex subunit LAGE3
Target Function
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. LAGE3 functions as a dimerization module for the complex.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
CTAG/PCC1 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
LAGE3; DXS9879E; ESO3; ITBA2EKC/KEOPS complex subunit LAGE3; L antigen family member 3; Protein ESO-3; Protein ITBA2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
